%global _empty_manifest_terminate_build 0 Name: python-biocommons.seqrepo Version: 0.6.5 Release: 1 Summary: Non-redundant, compressed, journalled, file-based storage for biological sequences License: Apache Software License URL: https://github.com/biocommons/biocommons.seqrepo Source0: https://mirrors.nju.edu.cn/pypi/web/packages/f1/55/7bff2f7bd3971925d18bdfb9e666b6d0bb1abd7f28da7a82a19fc5a6529f/biocommons.seqrepo-0.6.5.tar.gz BuildArch: noarch Requires: python3-bioutils Requires: python3-coloredlogs Requires: python3-ipython Requires: python3-pysam Requires: python3-requests Requires: python3-requests-html Requires: python3-six Requires: python3-tqdm Requires: python3-yoyo-migrations Requires: python3-tox %description biocommons.seqrepo !!!!!!!!!!!!!!!!!! Python package for writing and reading a local collection of biological sequences. The repository is non-redundant, compressed, and journalled, making it efficient to store and transfer multiple snapshots. Clients refer to sequences and metadata using familiar identifiers, such as NM_000551.3 or GRCh38:1, or any of several hash-based identifiers. The interface supports fast slicing of arbitrary regions of large sequences. A "fully-qualified" identifier includes a namespace to disambiguate accessions (e.g., "1" in GRCh37 and GRCh38). If the namespace is provided, seqrepo uses it as-is. If the namespace is not provided and the unqualified identifier refers to a unique sequence, it is returned; otherwise, ambiguous identifiers will raise an error. SeqRepo favors identifiers from [identifiers.org](identifiers.org) whenever available. Examples include [refseq](https://registry.identifiers.org/registry/refseq) and [ensembl](https://registry.identifiers.org/registry/ensembl). `seqrepo-rest-service `__ provides a REST interface and docker image. Released under the Apache License, 2.0. |ci_rel| | |cov| | |pypi_rel| | `ChangeLog `_ Citation !!!!!!!! | Hart RK, Prlić A (2020) | SeqRepo: A system for managing local collections of biological sequences. | PLoS ONE 15(12): e0239883. https://doi.org/10.1371/journal.pone.0239883 Features !!!!!!!! * Timestamped, read-only snapshots. * Space-efficient storage of sequences within a single snapshot and across snapshots. * Bandwidth-efficient transfer incremental updates. * Fast fetching of sequence slices on chromosome-scale sequences. * Precomputed digests that may be used as sequence aliases. * Mappings of external aliases (i.e., accessions or identifiers like NM_013305.4) to sequences. Deployments Scenarios !!!!!!!!!!!!!!!!!!!!! * Local read-only archive, mirrored from public site, accessed via Python API (see `Mirroring documentation `__) * Local read-write archive, maintained with command line utility and/or API (see `Command Line Interface documentation `__). * Docker data-only container that may be linked to application container. * SeqRepo and refget REST API for local or remote access (see `seqrepo-rest-service `__) Technical Quick Peek !!!!!!!!!!!!!!!!!!!! Within a single snapshot, sequences are stored *non-redundantly* and *compressed* in an add-only journalled filesystem structure. A truncated SHA-512 hash is used to assess uniquness and as an internal id. (The digest is truncated for space efficiency.) Sequences are compressed using the Block GZipped Format (`BGZF `__)), which enables pysam to provide fast random access to compressed sequences. (Variable compression typically makes random access impossible.) Sequence files are immutable, thereby enabling the use of hardlinks across snapshots and eliminating redundant transfers (e.g., with rsync). Each sequence id is associated with a namespaced alias in a sqlite database. Such as ````, ````, ````, ````, ````. The sqlite database is mutable across releases. For calibration, recent releases that include 3 human genome assemblies (including patches), and full RefSeq sets (NM, NR, NP, NT, XM, and XP) consumes approximately 8GB. The minimum marginal size for additional snapshots is approximately 2GB (for the sqlite database, which is not hardlinked). For more information, see ``__. Requirements !!!!!!!!!!!! Reading a sequence repository requires several Python packages, all of which are available from pypi. Installation should be as simple as `pip install biocommons.seqrepo`. *Writing* sequence files also requires ``bgzip``, which provided in the `htslib `__ repo. Ubuntu users should install the ``tabix`` package with ``sudo apt install tabix``. Development and deployments are on Ubuntu. Other systems may work but are not tested. Patches to get other systems working would be welcomed. **Mac Developers** If you get "xcrun: error: invalid active developer path", you need to install XCode. See this `StackOverflow answer `__. Quick Start !!!!!!!!!!! On Ubuntu 16.04:: $ sudo apt install -y python3-dev gcc zlib1g-dev tabix $ pip install seqrepo $ sudo mkdir /usr/local/share/seqrepo $ sudo chown $USER /usr/local/share/seqrepo $ seqrepo pull -i 2018-11-26 $ seqrepo show-status -i 2018-11-26 seqrepo 0.2.3.post3.dev8+nb8298bd62283 root directory: /usr/local/share/seqrepo/2018-11-26, 7.9 GB backends: fastadir (schema 1), seqaliasdb (schema 1) sequences: 773587 sequences, 93051609959 residues, 192 files aliases: 5579572 aliases, 5480085 current, 26 namespaces, 773587 sequences # Simple Pythonic interface to sequences >> from biocommons.seqrepo import SeqRepo >> sr = SeqRepo("/usr/local/share/seqrepo/latest") >> sr["NC_000001.11"][780000:780020] 'TGGTGGCACGCGCTTGTAGT' # Or, use the seqrepo shell for even easier access $ seqrepo start-shell -i 2018-11-26 In [1]: sr["NC_000001.11"][780000:780020] Out[1]: 'TGGTGGCACGCGCTTGTAGT' # N.B. The following output is edited for simplicity $ seqrepo export -i 2018-11-26 | head -n100 >SHA1:9a2acba3dd7603f... SEGUID:mirLo912A/MppLuS1cUyFMduLUQ Ensembl-85:GENSCAN00000003538 ... MDSPLREDDSQTCARLWEAEVKRHSLEGLTVFGTAVQIHNVQRRAIRAKGTQEAQAELLCRGPRLLDRFLEDACILKEGRGTDTGQHCRGDARISSHLEA SGTHIQLLALFLVSSSDTPPSLLRFCHALEHDIRYNSSFDSYYPLSPHSRHNDDLQTPSSHLGYIITVPDPTLPLTFASLYLGMAPCTSMGSSSMGIFQS QRIHAFMKGKNKWDEYEGRKESWKIRSNSQTGEPTF >SHA1:ca996b263102b1... SEGUID:yplrJjECsVqQufeYy0HkDD16z58 NCBI:XR_001733142.1 gi:1034683989 TTTACGTCTTTCTGGGAATTTATACTGGAAGTATACTTACCTCTGTGCAAAATTGCAAATATATAAGGTAATTCATTCCAGCATTGCTTATATTAGGTTG AACTATGTAACATTGACATTGATGTGAATCAAAAATGGTTGAAGGCTGGCAGTTTCATATGATTCAGCCTATAATAGCAAAAGATTGAAAAAATCCATTA ATACAGTGTGGTTCAAAAAAATTTGTTGTATCAAGGTAAAATAATAGCCTGAATATAATTAAGATAGTCTGTGTATACATCGATGAAAACATTGCCAATA See `Installation `__ and `Mirroring `__ for more information. Environment Variables !!!!!!!!!!!!!!!!!!!!! SEQREPO_LRU_CACHE_MAXSIZE sets the lru_cache maxsize for the sqlite query response caching. It defaults to 1 million but can also be set to "none" to be unlimited. Developing !!!!!!!!!! Here's how to get started developing:: python3.6 -m venv source venv/bin/activate pip install -U setuptools pip make develop .. |pypi_rel| image:: https://badge.fury.io/py/biocommons.seqrepo.png :target: https://pypi.org/pypi?name=biocommons.seqrepo :align: middle .. |ci_rel| image:: https://travis-ci.org/biocommons/biocommons.seqrepo.svg?branch=master :target: https://travis-ci.org/biocommons/biocommons.seqrepo :align: middle .. |cov| image:: https://coveralls.io/repos/github/biocommons/biocommons.seqrepo/badge.svg?branch= :target: https://coveralls.io/github/biocommons/biocommons.seqrepo?branch= %package -n python3-biocommons.seqrepo Summary: Non-redundant, compressed, journalled, file-based storage for biological sequences Provides: python-biocommons.seqrepo BuildRequires: python3-devel BuildRequires: python3-setuptools BuildRequires: python3-pip %description -n python3-biocommons.seqrepo biocommons.seqrepo !!!!!!!!!!!!!!!!!! Python package for writing and reading a local collection of biological sequences. The repository is non-redundant, compressed, and journalled, making it efficient to store and transfer multiple snapshots. Clients refer to sequences and metadata using familiar identifiers, such as NM_000551.3 or GRCh38:1, or any of several hash-based identifiers. The interface supports fast slicing of arbitrary regions of large sequences. A "fully-qualified" identifier includes a namespace to disambiguate accessions (e.g., "1" in GRCh37 and GRCh38). If the namespace is provided, seqrepo uses it as-is. If the namespace is not provided and the unqualified identifier refers to a unique sequence, it is returned; otherwise, ambiguous identifiers will raise an error. SeqRepo favors identifiers from [identifiers.org](identifiers.org) whenever available. Examples include [refseq](https://registry.identifiers.org/registry/refseq) and [ensembl](https://registry.identifiers.org/registry/ensembl). `seqrepo-rest-service `__ provides a REST interface and docker image. Released under the Apache License, 2.0. |ci_rel| | |cov| | |pypi_rel| | `ChangeLog `_ Citation !!!!!!!! | Hart RK, Prlić A (2020) | SeqRepo: A system for managing local collections of biological sequences. | PLoS ONE 15(12): e0239883. https://doi.org/10.1371/journal.pone.0239883 Features !!!!!!!! * Timestamped, read-only snapshots. * Space-efficient storage of sequences within a single snapshot and across snapshots. * Bandwidth-efficient transfer incremental updates. * Fast fetching of sequence slices on chromosome-scale sequences. * Precomputed digests that may be used as sequence aliases. * Mappings of external aliases (i.e., accessions or identifiers like NM_013305.4) to sequences. Deployments Scenarios !!!!!!!!!!!!!!!!!!!!! * Local read-only archive, mirrored from public site, accessed via Python API (see `Mirroring documentation `__) * Local read-write archive, maintained with command line utility and/or API (see `Command Line Interface documentation `__). * Docker data-only container that may be linked to application container. * SeqRepo and refget REST API for local or remote access (see `seqrepo-rest-service `__) Technical Quick Peek !!!!!!!!!!!!!!!!!!!! Within a single snapshot, sequences are stored *non-redundantly* and *compressed* in an add-only journalled filesystem structure. A truncated SHA-512 hash is used to assess uniquness and as an internal id. (The digest is truncated for space efficiency.) Sequences are compressed using the Block GZipped Format (`BGZF `__)), which enables pysam to provide fast random access to compressed sequences. (Variable compression typically makes random access impossible.) Sequence files are immutable, thereby enabling the use of hardlinks across snapshots and eliminating redundant transfers (e.g., with rsync). Each sequence id is associated with a namespaced alias in a sqlite database. Such as ````, ````, ````, ````, ````. The sqlite database is mutable across releases. For calibration, recent releases that include 3 human genome assemblies (including patches), and full RefSeq sets (NM, NR, NP, NT, XM, and XP) consumes approximately 8GB. The minimum marginal size for additional snapshots is approximately 2GB (for the sqlite database, which is not hardlinked). For more information, see ``__. Requirements !!!!!!!!!!!! Reading a sequence repository requires several Python packages, all of which are available from pypi. Installation should be as simple as `pip install biocommons.seqrepo`. *Writing* sequence files also requires ``bgzip``, which provided in the `htslib `__ repo. Ubuntu users should install the ``tabix`` package with ``sudo apt install tabix``. Development and deployments are on Ubuntu. Other systems may work but are not tested. Patches to get other systems working would be welcomed. **Mac Developers** If you get "xcrun: error: invalid active developer path", you need to install XCode. See this `StackOverflow answer `__. Quick Start !!!!!!!!!!! On Ubuntu 16.04:: $ sudo apt install -y python3-dev gcc zlib1g-dev tabix $ pip install seqrepo $ sudo mkdir /usr/local/share/seqrepo $ sudo chown $USER /usr/local/share/seqrepo $ seqrepo pull -i 2018-11-26 $ seqrepo show-status -i 2018-11-26 seqrepo 0.2.3.post3.dev8+nb8298bd62283 root directory: /usr/local/share/seqrepo/2018-11-26, 7.9 GB backends: fastadir (schema 1), seqaliasdb (schema 1) sequences: 773587 sequences, 93051609959 residues, 192 files aliases: 5579572 aliases, 5480085 current, 26 namespaces, 773587 sequences # Simple Pythonic interface to sequences >> from biocommons.seqrepo import SeqRepo >> sr = SeqRepo("/usr/local/share/seqrepo/latest") >> sr["NC_000001.11"][780000:780020] 'TGGTGGCACGCGCTTGTAGT' # Or, use the seqrepo shell for even easier access $ seqrepo start-shell -i 2018-11-26 In [1]: sr["NC_000001.11"][780000:780020] Out[1]: 'TGGTGGCACGCGCTTGTAGT' # N.B. The following output is edited for simplicity $ seqrepo export -i 2018-11-26 | head -n100 >SHA1:9a2acba3dd7603f... SEGUID:mirLo912A/MppLuS1cUyFMduLUQ Ensembl-85:GENSCAN00000003538 ... MDSPLREDDSQTCARLWEAEVKRHSLEGLTVFGTAVQIHNVQRRAIRAKGTQEAQAELLCRGPRLLDRFLEDACILKEGRGTDTGQHCRGDARISSHLEA SGTHIQLLALFLVSSSDTPPSLLRFCHALEHDIRYNSSFDSYYPLSPHSRHNDDLQTPSSHLGYIITVPDPTLPLTFASLYLGMAPCTSMGSSSMGIFQS QRIHAFMKGKNKWDEYEGRKESWKIRSNSQTGEPTF >SHA1:ca996b263102b1... SEGUID:yplrJjECsVqQufeYy0HkDD16z58 NCBI:XR_001733142.1 gi:1034683989 TTTACGTCTTTCTGGGAATTTATACTGGAAGTATACTTACCTCTGTGCAAAATTGCAAATATATAAGGTAATTCATTCCAGCATTGCTTATATTAGGTTG AACTATGTAACATTGACATTGATGTGAATCAAAAATGGTTGAAGGCTGGCAGTTTCATATGATTCAGCCTATAATAGCAAAAGATTGAAAAAATCCATTA ATACAGTGTGGTTCAAAAAAATTTGTTGTATCAAGGTAAAATAATAGCCTGAATATAATTAAGATAGTCTGTGTATACATCGATGAAAACATTGCCAATA See `Installation `__ and `Mirroring `__ for more information. Environment Variables !!!!!!!!!!!!!!!!!!!!! SEQREPO_LRU_CACHE_MAXSIZE sets the lru_cache maxsize for the sqlite query response caching. It defaults to 1 million but can also be set to "none" to be unlimited. Developing !!!!!!!!!! Here's how to get started developing:: python3.6 -m venv source venv/bin/activate pip install -U setuptools pip make develop .. |pypi_rel| image:: https://badge.fury.io/py/biocommons.seqrepo.png :target: https://pypi.org/pypi?name=biocommons.seqrepo :align: middle .. |ci_rel| image:: https://travis-ci.org/biocommons/biocommons.seqrepo.svg?branch=master :target: https://travis-ci.org/biocommons/biocommons.seqrepo :align: middle .. |cov| image:: https://coveralls.io/repos/github/biocommons/biocommons.seqrepo/badge.svg?branch= :target: https://coveralls.io/github/biocommons/biocommons.seqrepo?branch= %package help Summary: Development documents and examples for biocommons.seqrepo Provides: python3-biocommons.seqrepo-doc %description help biocommons.seqrepo !!!!!!!!!!!!!!!!!! Python package for writing and reading a local collection of biological sequences. The repository is non-redundant, compressed, and journalled, making it efficient to store and transfer multiple snapshots. Clients refer to sequences and metadata using familiar identifiers, such as NM_000551.3 or GRCh38:1, or any of several hash-based identifiers. The interface supports fast slicing of arbitrary regions of large sequences. A "fully-qualified" identifier includes a namespace to disambiguate accessions (e.g., "1" in GRCh37 and GRCh38). If the namespace is provided, seqrepo uses it as-is. If the namespace is not provided and the unqualified identifier refers to a unique sequence, it is returned; otherwise, ambiguous identifiers will raise an error. SeqRepo favors identifiers from [identifiers.org](identifiers.org) whenever available. Examples include [refseq](https://registry.identifiers.org/registry/refseq) and [ensembl](https://registry.identifiers.org/registry/ensembl). `seqrepo-rest-service `__ provides a REST interface and docker image. Released under the Apache License, 2.0. |ci_rel| | |cov| | |pypi_rel| | `ChangeLog `_ Citation !!!!!!!! | Hart RK, Prlić A (2020) | SeqRepo: A system for managing local collections of biological sequences. | PLoS ONE 15(12): e0239883. https://doi.org/10.1371/journal.pone.0239883 Features !!!!!!!! * Timestamped, read-only snapshots. * Space-efficient storage of sequences within a single snapshot and across snapshots. * Bandwidth-efficient transfer incremental updates. * Fast fetching of sequence slices on chromosome-scale sequences. * Precomputed digests that may be used as sequence aliases. * Mappings of external aliases (i.e., accessions or identifiers like NM_013305.4) to sequences. Deployments Scenarios !!!!!!!!!!!!!!!!!!!!! * Local read-only archive, mirrored from public site, accessed via Python API (see `Mirroring documentation `__) * Local read-write archive, maintained with command line utility and/or API (see `Command Line Interface documentation `__). * Docker data-only container that may be linked to application container. * SeqRepo and refget REST API for local or remote access (see `seqrepo-rest-service `__) Technical Quick Peek !!!!!!!!!!!!!!!!!!!! Within a single snapshot, sequences are stored *non-redundantly* and *compressed* in an add-only journalled filesystem structure. A truncated SHA-512 hash is used to assess uniquness and as an internal id. (The digest is truncated for space efficiency.) Sequences are compressed using the Block GZipped Format (`BGZF `__)), which enables pysam to provide fast random access to compressed sequences. (Variable compression typically makes random access impossible.) Sequence files are immutable, thereby enabling the use of hardlinks across snapshots and eliminating redundant transfers (e.g., with rsync). Each sequence id is associated with a namespaced alias in a sqlite database. Such as ````, ````, ````, ````, ````. The sqlite database is mutable across releases. For calibration, recent releases that include 3 human genome assemblies (including patches), and full RefSeq sets (NM, NR, NP, NT, XM, and XP) consumes approximately 8GB. The minimum marginal size for additional snapshots is approximately 2GB (for the sqlite database, which is not hardlinked). For more information, see ``__. Requirements !!!!!!!!!!!! Reading a sequence repository requires several Python packages, all of which are available from pypi. Installation should be as simple as `pip install biocommons.seqrepo`. *Writing* sequence files also requires ``bgzip``, which provided in the `htslib `__ repo. Ubuntu users should install the ``tabix`` package with ``sudo apt install tabix``. Development and deployments are on Ubuntu. Other systems may work but are not tested. Patches to get other systems working would be welcomed. **Mac Developers** If you get "xcrun: error: invalid active developer path", you need to install XCode. See this `StackOverflow answer `__. Quick Start !!!!!!!!!!! On Ubuntu 16.04:: $ sudo apt install -y python3-dev gcc zlib1g-dev tabix $ pip install seqrepo $ sudo mkdir /usr/local/share/seqrepo $ sudo chown $USER /usr/local/share/seqrepo $ seqrepo pull -i 2018-11-26 $ seqrepo show-status -i 2018-11-26 seqrepo 0.2.3.post3.dev8+nb8298bd62283 root directory: /usr/local/share/seqrepo/2018-11-26, 7.9 GB backends: fastadir (schema 1), seqaliasdb (schema 1) sequences: 773587 sequences, 93051609959 residues, 192 files aliases: 5579572 aliases, 5480085 current, 26 namespaces, 773587 sequences # Simple Pythonic interface to sequences >> from biocommons.seqrepo import SeqRepo >> sr = SeqRepo("/usr/local/share/seqrepo/latest") >> sr["NC_000001.11"][780000:780020] 'TGGTGGCACGCGCTTGTAGT' # Or, use the seqrepo shell for even easier access $ seqrepo start-shell -i 2018-11-26 In [1]: sr["NC_000001.11"][780000:780020] Out[1]: 'TGGTGGCACGCGCTTGTAGT' # N.B. The following output is edited for simplicity $ seqrepo export -i 2018-11-26 | head -n100 >SHA1:9a2acba3dd7603f... SEGUID:mirLo912A/MppLuS1cUyFMduLUQ Ensembl-85:GENSCAN00000003538 ... MDSPLREDDSQTCARLWEAEVKRHSLEGLTVFGTAVQIHNVQRRAIRAKGTQEAQAELLCRGPRLLDRFLEDACILKEGRGTDTGQHCRGDARISSHLEA SGTHIQLLALFLVSSSDTPPSLLRFCHALEHDIRYNSSFDSYYPLSPHSRHNDDLQTPSSHLGYIITVPDPTLPLTFASLYLGMAPCTSMGSSSMGIFQS QRIHAFMKGKNKWDEYEGRKESWKIRSNSQTGEPTF >SHA1:ca996b263102b1... SEGUID:yplrJjECsVqQufeYy0HkDD16z58 NCBI:XR_001733142.1 gi:1034683989 TTTACGTCTTTCTGGGAATTTATACTGGAAGTATACTTACCTCTGTGCAAAATTGCAAATATATAAGGTAATTCATTCCAGCATTGCTTATATTAGGTTG AACTATGTAACATTGACATTGATGTGAATCAAAAATGGTTGAAGGCTGGCAGTTTCATATGATTCAGCCTATAATAGCAAAAGATTGAAAAAATCCATTA ATACAGTGTGGTTCAAAAAAATTTGTTGTATCAAGGTAAAATAATAGCCTGAATATAATTAAGATAGTCTGTGTATACATCGATGAAAACATTGCCAATA See `Installation `__ and `Mirroring `__ for more information. Environment Variables !!!!!!!!!!!!!!!!!!!!! SEQREPO_LRU_CACHE_MAXSIZE sets the lru_cache maxsize for the sqlite query response caching. It defaults to 1 million but can also be set to "none" to be unlimited. Developing !!!!!!!!!! Here's how to get started developing:: python3.6 -m venv source venv/bin/activate pip install -U setuptools pip make develop .. |pypi_rel| image:: https://badge.fury.io/py/biocommons.seqrepo.png :target: https://pypi.org/pypi?name=biocommons.seqrepo :align: middle .. |ci_rel| image:: https://travis-ci.org/biocommons/biocommons.seqrepo.svg?branch=master :target: https://travis-ci.org/biocommons/biocommons.seqrepo :align: middle .. |cov| image:: https://coveralls.io/repos/github/biocommons/biocommons.seqrepo/badge.svg?branch= :target: https://coveralls.io/github/biocommons/biocommons.seqrepo?branch= %prep %autosetup -n biocommons.seqrepo-0.6.5 %build %py3_build %install %py3_install install -d -m755 %{buildroot}/%{_pkgdocdir} if [ -d doc ]; then cp -arf doc %{buildroot}/%{_pkgdocdir}; fi if [ -d docs ]; then cp -arf docs %{buildroot}/%{_pkgdocdir}; fi if [ -d example ]; then cp -arf example %{buildroot}/%{_pkgdocdir}; fi if [ -d examples ]; then cp -arf examples %{buildroot}/%{_pkgdocdir}; fi pushd %{buildroot} if [ -d usr/lib ]; then find usr/lib -type f -printf "/%h/%f\n" >> filelist.lst fi if [ -d usr/lib64 ]; then find usr/lib64 -type f -printf "/%h/%f\n" >> filelist.lst fi if [ -d usr/bin ]; then find usr/bin -type f -printf "/%h/%f\n" >> filelist.lst fi if [ -d usr/sbin ]; then find usr/sbin -type f -printf "/%h/%f\n" >> filelist.lst fi touch doclist.lst if [ -d usr/share/man ]; then find usr/share/man -type f -printf "/%h/%f.gz\n" >> doclist.lst fi popd mv %{buildroot}/filelist.lst . mv %{buildroot}/doclist.lst . %files -n python3-biocommons.seqrepo -f filelist.lst %dir %{python3_sitelib}/* %files help -f doclist.lst %{_docdir}/* %changelog * Tue Apr 25 2023 Python_Bot - 0.6.5-1 - Package Spec generated